Fields »
ABOUT
HELP
BLOG
CT45A9

ANTIBODY INFORMATION
 
 

Antibody HPA044735

  

Antibody HPA044757

  

Antibody HPA046872

  

Antibody HPA046987

  

Provider

 Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
  

Product name

 HPA044735   HPA044757   HPA046872   HPA046987  

Host species

 Rabbit   Rabbit   Rabbit   Rabbit  

Clonality

 pAb   pAb   pAb   pAb  

Purity

 Affinity purified using the PrEST-antigen as affinity ligand   Affinity purified using the PrEST-antigen as affinity ligand   Affinity purified using the PrEST-antigen as affinity ligand   Affinity purified using the PrEST-antigen as affinity ligand  

Other gene match

 CT45A5 - ENSG00000228836 [100%]
CT45A1 - ENSG00000268940 [100%]
CT45A3 - ENSG00000269096 [100%]
CT45A10 - ENSG00000269586 [100%]
CT45A2 - ENSG00000271449 [100%]
CT45A7 - ENSG00000273696 [100%]
CT45A8 - ENSG00000278085 [100%]
CT45A6 - ENSG00000278289 [100%]
   CT45A5 - ENSG00000228836 [100%]
CT45A1 - ENSG00000268940 [100%]
CT45A3 - ENSG00000269096 [100%]
CT45A10 - ENSG00000269586 [100%]
CT45A2 - ENSG00000271449 [100%]
CT45A7 - ENSG00000273696 [100%]
CT45A8 - ENSG00000278085 [100%]
CT45A6 - ENSG00000278289 [100%]
   CT45A5 - ENSG00000228836 [100%]
CT45A1 - ENSG00000268940 [100%]
CT45A3 - ENSG00000269096 [100%]
CT45A10 - ENSG00000269586 [100%]
CT45A2 - ENSG00000271449 [100%]
CT45A7 - ENSG00000273696 [100%]
CT45A8 - ENSG00000278085 [100%]
CT45A6 - ENSG00000278289 [100%]
   CT45A5 - ENSG00000228836 [100%]
CT45A1 - ENSG00000268940 [100%]
CT45A3 - ENSG00000269096 [100%]
CT45A10 - ENSG00000269586 [90%]
CT45A2 - ENSG00000271449 [95%]
CT45A7 - ENSG00000273696 [100%]
CT45A8 - ENSG00000278085 [95%]
CT45A6 - ENSG00000278289 [100%]
  

Released in version

 12   12   12   12  

References

        

Proper citation

 Atlas Antibodies Cat#HPA044735, RRID:AB_2679065   Atlas Antibodies Cat#HPA044757, RRID:AB_2679075   Atlas Antibodies Cat#HPA046872, RRID:AB_2679849   Atlas Antibodies Cat#HPA046987, RRID:AB_2679893  

VALIDATION SUMMARY
 
 

Antibody HPA044735

  

Antibody HPA044757

  

Antibody HPA046872

  

Antibody HPA046987

  
Immunocytochemistry

Approved     Approved   Approved  
Immunohistochemistry

Supported   Supported   Supported   Supported  
Western blot

Uncertain   Uncertain   Uncertain   Uncertain  
Protein array

Supported   Supported   Supported   Supported  

IMMUNOCYTOCHEMISTRY
 
 

Antibody HPA044735

  

Antibody HPA044757

  

Antibody HPA046872

  

Antibody HPA046987

  

Standard validation

 Approved     Approved   Approved  

       

Figure description

 Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.     Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.   Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.  

Antibody dilution

 1:53     1:6   1:54  

Literature conformity

 The subcellular location is partly supported by literature or no literature is available.     The subcellular location is partly supported by literature or no literature is available.   The subcellular location is partly supported by literature or no literature is available.  

IMMUNOHISTOCHEMISTRY
 
 

Antibody HPA044735

  

Antibody HPA044757

  

Antibody HPA046872

  

Antibody HPA046987

  

Standard validation

 Supported   Supported   Supported   Supported  

       

Figure description

 Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.   Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.   Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.   Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.  

Expression

 RNA: detected in 1 tissues
Protein: detected in 7 cell types		   RNA: detected in 1 tissues
Protein: detected in 16 cell types		   RNA: detected in 1 tissues
Protein: detected in 3 cell types		   RNA: detected in 1 tissues
Protein: detected in 34 cell types		  

Retrieval

 HIER pH6   HIER pH6   HIER pH6   HIER pH6  

Antibody dilution

 1:2000   1:150   1:25   1:450  

Literature conformity

 No avaliable gene/protein characterization data.   No avaliable gene/protein characterization data.   No avaliable gene/protein characterization data.   No avaliable gene/protein characterization data.  

RNA consistency

 Consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.  

WESTERN BLOT
 
 

Antibody HPA044735

  

Antibody HPA044757

  

Antibody HPA046872

  

Antibody HPA046987

  

Standard validation

 Uncertain

Analysis performed using a standard panel of samples.
Current setup is not applicable due to low RNA count.		   Uncertain

Analysis performed using a standard panel of samples.
Current setup is not applicable due to low RNA count.		   Uncertain

Analysis performed using a standard panel of samples.
Current setup is not applicable due to low RNA count.		   Uncertain

Analysis performed using a standard panel of samples.
Current setup is not applicable due to low RNA count.		  

       

Figure description

        

Target mass (kDa)

 21.4, 21.3, 21.2, 21.1   21.4, 21.3, 21.2, 21.1   21.4, 21.3, 21.2, 21.1   21.4, 21.3, 21.2, 21.1  

Antibody dilution

 1:250   1:250   1:80   1:270  

PROTEIN ARRAY
 
 

Antibody HPA044735

  

Antibody HPA044757

  

Antibody HPA046872

  

Antibody HPA046987

  

Standard validation

 Supported

Pass with single peak corresponding to interaction only with its own antigen.		   Supported

Pass with single peak corresponding to interaction only with its own antigen.		   Supported

Pass with single peak corresponding to interaction only with its own antigen.		   Supported

Pass with single peak corresponding to interaction only with its own antigen.		  

       

Figure description

 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.   Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.   Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.   Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.  

Antibody dilution

 1:3000   1:3000   1:500   1:6000  

ANTIGEN INFORMATION
 
 

Antibody HPA044735

  

Antibody HPA044757

  

Antibody HPA046872

  

Antibody HPA046987

  

Antigen

 Recombinant protein fragment   Recombinant protein fragment   Recombinant protein fragment   Recombinant protein fragment  

Length (aa)

 50   38   26   39  

Antigen sequence

 
TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK
  
QGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
  
KKLMTGHAIPPSQLDSQIDDFTGFSK
  
PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI
 

Matching transcripts

 CT45A9-001 - ENSP00000483637 [100%]
CT45A9-201 - ENSP00000475060 [100%]
  CT45A9-001 - ENSP00000483637 [100%]
CT45A9-201 - ENSP00000475060 [100%]
  CT45A9-001 - ENSP00000483637 [100%]
CT45A9-201 - ENSP00000475060 [100%]
  CT45A9-001 - ENSP00000483637 [95%]
CT45A9-201 - ENSP00000475060 [95%]
 

Other gene match

 CT45A5 - ENSG00000228836 [100%]
CT45A1 - ENSG00000268940 [100%]
CT45A3 - ENSG00000269096 [100%]
CT45A10 - ENSG00000269586 [100%]
CT45A2 - ENSG00000271449 [100%]
CT45A7 - ENSG00000273696 [100%]
CT45A8 - ENSG00000278085 [100%]
CT45A6 - ENSG00000278289 [100%]
   CT45A5 - ENSG00000228836 [100%]
CT45A1 - ENSG00000268940 [100%]
CT45A3 - ENSG00000269096 [100%]
CT45A10 - ENSG00000269586 [100%]
CT45A2 - ENSG00000271449 [100%]
CT45A7 - ENSG00000273696 [100%]
CT45A8 - ENSG00000278085 [100%]
CT45A6 - ENSG00000278289 [100%]
   CT45A5 - ENSG00000228836 [100%]
CT45A1 - ENSG00000268940 [100%]
CT45A3 - ENSG00000269096 [100%]
CT45A10 - ENSG00000269586 [100%]
CT45A2 - ENSG00000271449 [100%]
CT45A7 - ENSG00000273696 [100%]
CT45A8 - ENSG00000278085 [100%]
CT45A6 - ENSG00000278289 [100%]
   CT45A5 - ENSG00000228836 [100%]
CT45A1 - ENSG00000268940 [100%]
CT45A3 - ENSG00000269096 [100%]
CT45A10 - ENSG00000269586 [90%]
CT45A2 - ENSG00000271449 [95%]
CT45A7 - ENSG00000273696 [100%]
CT45A8 - ENSG00000278085 [95%]
CT45A6 - ENSG00000278289 [100%]
  
ANTIGEN VIEW
CT45A9-001
CT45A9-201
 

Contact

The Project

The Human Protein Atlas

The Human Protein Atlas project is funded
by the Knut & Alice Wallenberg foundation.