Fields »
ABOUT
HELP
BLOG
SATB2

ANTIBODY INFORMATION
 
 

Antibody HPA001042

  

Antibody HPA029543

  

Antibody CAB023669

  

Antibody CAB062562

  

Antibody CAB067751

  

Antibody CAB068229

  

Antibody CAB068230

  

Antibody CAB068231

  

Provider

 Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Santa Cruz Biotechnology
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
  

Product name

 HPA001042   HPA029543   sc-81376   AMAb90635   AMAb90679   AMAb90678   AMAb90680   AMAb90682  

Host species

 Rabbit   Rabbit   Mouse   Mouse   Mouse   Mouse   Mouse   Mouse  

Clonality

 pAb   pAb   mAb   mAb   mAb   mAb   mAb   mAb  

Purity

 Affinity purified using the PrEST-antigen as affinity ligand   Affinity purified using the PrEST-antigen as affinity ligand   Protein A/G   Protein A/G   Protein A/G   Protein A/G   Protein A/G   Protein A/G  

Other gene match

                

Released in version

 6   9   9   12   13   13   13   13  

References

 4   1              

Proper citation

 Atlas Antibodies Cat#HPA001042, RRID:AB_10601711   Atlas Antibodies Cat#HPA029543, RRID:AB_10959737   Santa Cruz Biotechnology Cat#sc-81376, RRID:AB_1129287   Atlas Antibodies Cat#AMAb90635, RRID:AB_2665615   Atlas Antibodies Cat#AMAb90679, RRID:AB_2665629   Atlas Antibodies Cat#AMAb90678, RRID:AB_2665628   Atlas Antibodies Cat#AMAb90680, RRID:AB_2665630   Atlas Antibodies Cat#AMAb90682, RRID:AB_2665631  

VALIDATION SUMMARY
 
 

Antibody HPA001042

  

Antibody HPA029543

  

Antibody CAB023669

  

Antibody CAB062562

  

Antibody CAB067751

  

Antibody CAB068229

  

Antibody CAB068230

  

Antibody CAB068231

  
Immunocytochemistry

  Supported              
Immunohistochemistry


Validated

Validated
  

Validated
   Supported   Supported  

Validated
  

Validated
  

Validated
  

Validated
  
Western blot

Uncertain   Uncertain   Supported   Uncertain   Uncertain   Uncertain   Uncertain   Supported  
Protein array

Supported   Supported              

IMMUNOCYTOCHEMISTRY
 
 

Antibody HPA001042

  

Antibody HPA029543

  

Antibody CAB023669

  

Antibody CAB062562

  

Antibody CAB067751

  

Antibody CAB068229

  

Antibody CAB068230

  

Antibody CAB068231

  

Standard validation

   Supported              

               

Figure description

   Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.              

Antibody dilution

   1:20              

Literature conformity

   The subcellular location is supported by literature.              

IMMUNOHISTOCHEMISTRY
 
 

Antibody HPA001042

  

Antibody HPA029543

  

Antibody CAB023669

  

Antibody CAB062562

  

Antibody CAB067751

  

Antibody CAB068229

  

Antibody CAB068230

  

Antibody CAB068231

  

Formal validation: Orthogonal
Validated

Pearson correlation >0.6 for protein and RNA expression in cell lines.		        
Validated

Pearson correlation >0.6 for protein and RNA expression in cell lines.		  
Validated

Pearson correlation >0.6 for protein and RNA expression in cell lines.		  
Validated

Pearson correlation >0.6 for protein and RNA expression in cell lines.		  
Validated

Pearson correlation >0.6 for protein and RNA expression in cell lines.		  

       
 
 
 
 

Figure description

 Distribution of protein expression (antibody staining) and RNA expression (TPM) across 44 cell lines.         Distribution of protein expression (antibody staining) and RNA expression (TPM) across 44 cell lines.   Distribution of protein expression (antibody staining) and RNA expression (TPM) across 44 cell lines.   Distribution of protein expression (antibody staining) and RNA expression (TPM) across 44 cell lines.   Distribution of protein expression (antibody staining) and RNA expression (TPM) across 44 cell lines.  
 

Formal validation: Orthogonal

        
Validated

Spearman correlation >0.6 for protein and RNA expression in tissues.		      
Validated

Spearman correlation >0.6 for protein and RNA expression in tissues.		  

       
     
 

Figure description

         Distribution of protein expression (antibody staining) and RNA expression (TPM) across 37 tissues.       Distribution of protein expression (antibody staining) and RNA expression (TPM) across 37 tissues.  
 

Formal validation: Independent
Validated

Spearman correlation >0.6 for protein expression in tissues using independent antibodies.		  
Validated

Spearman correlation >0.6 for protein expression in tissues using independent antibodies.		              

 
             

Figure description

 Distribution of protein expression (antibody staining).
Spearman correlation with HPA029543 across 72 cell types.		   Distribution of protein expression (antibody staining).
Spearman correlation with HPA001042 across 72 cell types.		              
 

Standard validation

 Supported   Supported   Supported   Supported   Supported   Supported   Supported   Supported  

               

Figure description

 Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.   Immunohistochemical staining of human rectum shows nuclear positivity in glandular cells.   Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.   Immunohistochemical staining of human colon shows distinct nuclear positivity in glandular cells.   Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.   Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.   Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.   Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.  

Expression

 RNA: detected in 26 tissues
Protein: detected in 10 cell types		   RNA: detected in 26 tissues
Protein: detected in 6 cell types		   RNA: detected in 26 tissues
Protein: detected in 19 cell types		   RNA: detected in 26 tissues
Protein: detected in 10 cell types		   RNA: detected in 26 tissues
Protein: detected in 7 cell types		   RNA: detected in 26 tissues
Protein: detected in 5 cell types		   RNA: detected in 26 tissues
Protein: detected in 5 cell types		   RNA: detected in 26 tissues
Protein: detected in 7 cell types		  

Retrieval

 HIER pH6   HIER pH6   HIER pH6   HIER pH6   HIER pH6   HIER pH6   HIER pH6   HIER pH6  

Antibody dilution

 1:50   1:500   1:100   1:300   1:1000   1:500   1:250   1:1000  

Literature conformity

 Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.  

RNA consistency

 Consistent with RNA expression data.   Consistent with RNA expression data.   Consistent with RNA expression data.   Consistent with RNA expression data.   Consistent with RNA expression data.   Consistent with RNA expression data.   Consistent with RNA expression data.   Consistent with RNA expression data.  

WESTERN BLOT
 
 

Antibody HPA001042

  

Antibody HPA029543

  

Antibody CAB023669

  

Antibody CAB062562

  

Antibody CAB067751

  

Antibody CAB068229

  

Antibody CAB068230

  

Antibody CAB068231

  

Standard validation

 Uncertain

Analysis performed using a standard panel of samples.
Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data.		   Uncertain

Analysis performed using a standard panel of samples.
No bands detected.		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Uncertain

Analysis performed using a standard panel of samples.
Weak band of predicted size but with additional bands of higher intensity also present.		   Uncertain

Analysis performed using a standard panel of samples.
No bands detected.		   Uncertain

Analysis performed using a standard panel of samples.
No bands detected.		   Uncertain

Analysis performed using a standard panel of samples.
No bands detected.		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		  

               

Figure description

 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		     Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		  

Target mass (kDa)

 82.6, 76, 69.1   82.6, 76   82.6, 76, 69.1   82.6, 76, 69.1   82.6, 76, 69.1   82.6, 76, 69.1   82.6, 76, 69.1   82.6, 76, 69.1  

Antibody dilution

 1:500   1:250   1:500   1:500   1:1000   1:1000   1:1000   1:1000  

PROTEIN ARRAY
 
 

Antibody HPA001042

  

Antibody HPA029543

  

Antibody CAB023669

  

Antibody CAB062562

  

Antibody CAB067751

  

Antibody CAB068229

  

Antibody CAB068230

  

Antibody CAB068231

  

Standard validation

 Supported

Pass with single peak corresponding to interaction only with its own antigen.		   Supported

Pass with single peak corresponding to interaction only with its own antigen.		              

               

Figure description

 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.   Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.              

Antibody dilution

 1:2000   1:500              

ANTIGEN INFORMATION
 
 

Antibody HPA001042

  

Antibody HPA029543

  

Antibody CAB023669

  

Antibody CAB062562

  

Antibody CAB067751

  

Antibody CAB068229

  

Antibody CAB068230

  

Antibody CAB068231

  

Antigen

 Recombinant protein fragment   Recombinant protein fragment   Recombinant protein   Recombinant protein   Recombinant protein   Recombinant protein   Recombinant protein   Recombinant protein  

Length (aa)

 123   115              

Antigen sequence

 
VSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSLLVNLRAMQNFLNLPE
VERDRIYQDERERSMNPNVSMVSSASSSPSSSRTPQAKTSTPTTDLPIKV
DGANINITAAIYDEIQQEMKRAK
  
KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENL
SDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPI
MSPGLLSPQLSPQLV
  

											 
																						

											 
																						

											 
																						

											 
																						

											 
																						

											 
																				

																		

										
											
Matching transcripts

												
																					SATB2-001 - ENSP00000401112 [100%] 
SATB2-002 - ENSP00000405420 [100%] 
SATB2-003 - ENSP00000260926 [100%] 
SATB2-007 - ENSP00000388581 [100%] 
SATB2-010 - ENSP00000388764 [100%] 
SATB2-201 - ENSP00000483287 [100%] 

											 
																						SATB2-001 - ENSP00000401112 [100%] 
SATB2-002 - ENSP00000405420 [100%] 
SATB2-003 - ENSP00000260926 [100%] 
SATB2-010 - ENSP00000388764 [100%] 

											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																				

																		

										
											
Other gene match

												
																					
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																				

																		

										ANTIGEN VIEW
									
									
										

		
			

				

										
						

							

								

									
SATB2-001
SATB2-002
SATB2-003
SATB2-007
SATB2-010
SATB2-201
								

							

						

							
									

			

				
	

	

		
					
	

													
															
				
											

									
										
										
										
										
RELEVANT PUBLICATIONS

											
								

								

									 
								

								

									 
																			
											
											
											
Antibody HPA001042

												
										 
																				
											
											
											
Antibody HPA029543

												
										 
																				
											
											
											
Antibody CAB023669

												
										 
																				
											
											
											
Antibody CAB062562

												
										 
																				
											
											
											
Antibody CAB067751

												
										 
																				
											
											
											
Antibody CAB068229

												
										 
																				
											
											
											
Antibody CAB068230

												
										 
																				
											
											
											
Antibody CAB068231

												
										 
																		

																	

										
											
1.

												
																						Extensive expression of craniofacial related homeobox genes in canine mammary sarcomas

	Wensman H et al

	Breast Cancer Res Treat 2009;118(2):333-43

			
											 
																							Molecular correlates and prognostic significance of SATB1 expression in colorectal cancer

	Nodin B et al

	Diagn Pathol 2012;7:115

			
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																				

																		

										
											
2.

												
																						From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies

	Ek S et al

	Mol Cell Proteomics 2006;5(6):1072-81

			
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																				

																		

										
											
3.

												
																						SATB2 in combination with cytokeratin 20 identifies over 95% of all colorectal carcinomas

	Magnusson K et al

	Am J Surg Pathol 2011;35(7):937-48

			
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																				

																		

										
											
4.

												
																						Generation of monospecific antibodies based on affinity capture of polyclonal antibodies

	Hjelm B et al

	Protein Sci 2011;20(11):1824-35

			
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																				

															
				
						

				 
			

		

			
	











	

		


			

				

					Contact
				

				
				

					
					
					
					
				

				
			


			

				

					The Project
				
			
				
			

			
			

			
				

					The Human Protein Atlas
				

				
			

			
			

			

						The Human Protein Atlas project is funded
by the Knut & Alice Wallenberg foundation.