Fields »
ABOUT
HELP
BLOG
NIFK

ANTIBODY INFORMATION
 
 

Antibody HPA035735

  

Antibody HPA035736

  

Antibody CAB015382

  

Antibody CAB075728

  

Antibody CAB075729

  

Provider

 Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Santa Cruz Biotechnology
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
  

Product name

 HPA035735   HPA035736   sc-52904   AMAb90961   AMAb90962  

Host species

 Rabbit   Rabbit   Mouse   Mouse   Mouse  

Clonality

 pAb   pAb   mAb   mAb   mAb  

Purity

 Affinity purified using the PrEST-antigen as affinity ligand   Affinity purified using the PrEST-antigen as affinity ligand   Protein A/G   Protein A/G   Protein A/G  

Other gene match

          

Released in version

 12   12   4   14   14  

References

          

Proper citation

 Atlas Antibodies Cat#HPA035735, RRID:AB_2674758   Atlas Antibodies Cat#HPA035736, RRID:AB_2674759   Santa Cruz Biotechnology Cat#sc-52904, RRID:AB_2142390   Atlas Antibodies Cat#AMAb90961, RRID:AB_2665734   Atlas Antibodies Cat#AMAb90962, RRID:AB_2665735  

VALIDATION SUMMARY
 
 

Antibody HPA035735

  

Antibody HPA035736

  

Antibody CAB015382

  

Antibody CAB075728

  

Antibody CAB075729

  
Immunocytochemistry

Supported     Supported      
Immunohistochemistry

Supported   Supported   Supported   Supported   Supported  
Western blot


Validated
   Supported   Supported   Supported   Supported  
Protein array

Supported   Supported        

IMMUNOCYTOCHEMISTRY
 
 

Antibody HPA035735

  

Antibody HPA035736

  

Antibody CAB015382

  

Antibody CAB075728

  

Antibody CAB075729

  

Standard validation

 Supported     Supported      

         

Figure description

 Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.     Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.      

Antibody dilution

 1:200     1:13      

Literature conformity

 The subcellular location is supported by literature.     The subcellular location is supported by literature.      
 

Validation: Genetic

 Supported

Significant downregulation 10-25% by one/two siRNA:s		          

         

Figure description

 Nuclear region of segmented cells in 10x-images          

Antibody dilution

 1:200          

IMMUNOHISTOCHEMISTRY
 
 

Antibody HPA035735

  

Antibody HPA035736

  

Antibody CAB015382

  

Antibody CAB075728

  

Antibody CAB075729

  

Standard validation

 Supported   Supported   Supported   Supported   Supported  

         

Figure description

 Immunohistochemical staining of human fallopian tube shows nucleolar positivity in glandular cells.   Immunohistochemical staining of human hippocampus shows moderate nucleolar positivity in neuronal cells.   Immunohistochemical staining of human pancreas shows strong nucleolar positivity in exocrine glandular cells.   Immunohistochemical staining of human oral mucosa shows nucleolaar positivity in squamous epithelial cells.   Immunohistochemical staining of human skin shows nucleolar positivity in epidermal cells.  

Expression

 RNA: detected in 37 tissues
Protein: detected in 33 cell types		   RNA: detected in 37 tissues
Protein: detected in 33 cell types		   RNA: detected in 37 tissues
Protein: detected in 54 cell types		   RNA: detected in 37 tissues
Protein: detected in 35 cell types		   RNA: detected in 37 tissues
Protein: detected in 40 cell types		  

Retrieval

 HIER pH6   HIER pH6   HIER pH6   HIER pH6   HIER pH6  

Antibody dilution

 1:400   1:150   1:50   1:250   1:4000  

Literature conformity

 Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.  

RNA consistency

 Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.  

WESTERN BLOT
 
 

Antibody HPA035735

  

Antibody HPA035736

  

Antibody CAB015382

  

Antibody CAB075728

  

Antibody CAB075729

  

Formal validation: Genetic
Validated

Downregulation visible in both siRNA lanes		          

         

Figure description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: siRNA 1
Lane 3: siRNA 2
Lane 4: Scrambled		          

Target mass (kDa)

 34.2, 19.5          

Loading control

 Total protein image          

Antibody dilution

 1:835          
 

Standard validation

 Uncertain

Analysis performed using a standard panel of samples.
Weak band of predicted size but with additional bands of higher intensity also present.		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Supported

Analysis performed using a standard panel of samples.
Band of predicted size in kDa (+/-20%) with additional bands present.		  

         

Figure description

   Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		  

Target mass (kDa)

 34.2, 19.5   34.2, 19.6, 19.5   34.2, 19.6, 19.5, 11.7   34.2, 19.6, 19.5, 11.7   34.2, 19.6, 19.5, 11.7  

Antibody dilution

 1:250   1:250   1:500   1:500   1:500  

PROTEIN ARRAY
 
 

Antibody HPA035735

  

Antibody HPA035736

  

Antibody CAB015382

  

Antibody CAB075728

  

Antibody CAB075729

  

Standard validation

 Supported

Pass with single peak corresponding to interaction only with its own antigen.		   Supported

Pass with single peak corresponding to interaction only with its own antigen.		        

         

Figure description

 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.   Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.        

Antibody dilution

 1:3000   1:500        

ANTIGEN INFORMATION
 
 

Antibody HPA035735

  

Antibody HPA035736

  

Antibody CAB015382

  

Antibody CAB075728

  

Antibody CAB075729

  

Antigen

 Recombinant protein fragment   Recombinant protein fragment   Not known   Recombinant protein   Recombinant protein  

Length (aa)

 81   89        

Antigen sequence

 
IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDS
QGPTPVCTPTFLERRKSQVAELNDDDKDDEI
  
AFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPF
KQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLA
  

											 
																						

											 
																						

											 
																				

																		

										
											
Matching transcripts

												
																					NIFK-001 - ENSP00000285814 [100%] 
NIFK-005 - ENSP00000406227 [100%] 

											 
																						NIFK-001 - ENSP00000285814 [100%] 
NIFK-004 - ENSP00000398116 [100%] 
NIFK-005 - ENSP00000406227 [81%] 

											 
																						
											 
																						
											 
																						
											 
																				

																		

										
											
Other gene match

												
																					
											 
																						
											 
																						
											 
																						
											 
																						
											 
																				

																		

										ANTIGEN VIEW
									
									
										

		
			

				

										
						

							

								

									
NIFK-001
NIFK-004
NIFK-005
								

							

						

							
									

			

				
	

	

		
					
	

													
															
				
						

				 
			

		

			
	











	

		


			

				

					Contact
				

				
				

					
					
					
					
				

				
			


			

				

					The Project
				
			
				
			

			
			

			
				

					The Human Protein Atlas
				

				
			

			
			

			

						The Human Protein Atlas project is funded
by the Knut & Alice Wallenberg foundation.